Calbindin Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0802
- Bilder (2)
| Artikelname: | Calbindin Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0802 |
| Hersteller Artikelnummer: | A0802 |
| Alternativnummer: | ABB-A0802-20UL,ABB-A0802-100UL,ABB-A0802-500UL,ABB-A0802-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CALB, D-28K, Calbindin |
| The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 30kDa |
| NCBI: | 793 |
| UniProt: | P05937 |
| Reinheit: | Affinity purification |
| Sequenz: | MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALI |
| Target-Kategorie: | CALB1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Calcium Signaling,Neuron marker |


