Collagen III alpha 1/COL3A1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: Collagen III alpha 1/COL3A1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0817
• Hersteller Artikelnummer: A0817
• Alternativnummer: ABB-A0817-20UL,ABB-A0817-100UL,ABB-A0817-500UL,ABB-A0817-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EDS4A, EDSVASC, PMGEDSV, Collagen III alpha 1/COL3A1

Produktbeschreibung

This gene encodes the pro-alpha1 chains of type III collagen, a fibrillar collagen that is found in extensible connective tissues such as skin, lung, uterus, intestine and the vascular system, frequently in association with type I collagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC2542]
• Molekulargewicht: 139kDa
• NCBI: 1281
• UniProt: P02461
• Reinheit: Affinity purification
• Sequenz: NYSPQYDSYDVKSGVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGP
• Target-Kategorie: COL3A1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Stem Cells,Mesenchymal Stem Cells

Bilder