PDK1/PDHK1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: PDK1/PDHK1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0834
• Hersteller Artikelnummer: A0834
• Alternativnummer: ABB-A0834-100UL,ABB-A0834-20UL,ABB-A0834-500UL,ABB-A0834-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PDK1, PDK1/PDHK1

Produktbeschreibung

Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 49kDa
• NCBI: 5163
• UniProt: Q15118
• Reinheit: Affinity purification
• Sequenz: STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
• Target-Kategorie: PDK1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,PI3K-Akt Signaling Pathway,Endocrine Metabolism,Carbohydrate metabolism,Warburg Effect,Immunology Inflammation,T Cell Receptor Signaling Pathway,NF-kB Signaling Pathway

Bilder