cIAP1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: cIAP1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0866
• Hersteller Artikelnummer: A0866
• Alternativnummer: ABB-A0866-20UL,ABB-A0866-100UL,ABB-A0866-1000UL,ABB-A0866-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: API1, MIHB, HIAP2, RNF48, cIAP1, Hiap-2, c-IAP1

Produktbeschreibung

The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 70kDa
• NCBI: 329
• UniProt: Q13490
• Reinheit: Affinity purification
• Sequenz: PRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
• Target-Kategorie: BIRC2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Apoptosis,Caspases,Inhibition of Apoptosis,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Death Receptor Signaling Pathway,Endocrine Metabolism,Immunology Inflammation

Bilder