RPA70/RPA1 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0874
- Bilder (2)
| Artikelname: | RPA70/RPA1 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0874 |
| Hersteller Artikelnummer: | A0874 |
| Alternativnummer: | ABB-A0874-100UL,ABB-A0874-20UL,ABB-A0874-500UL,ABB-A0874-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HSSB, RF-A, RP-A, REPA1, RPA70, MST075, PFBMFT6, RPA70/RPA1 |
| This gene encodes the largest subunit of the heterotrimeric Replication Protein A (RPA) complex, which binds to single-stranded DNA (ssDNA), forming a nucleoprotein complex that plays an important role in DNA metabolism, being involved in DNA replication, repair, recombination, telomere maintenance, and co-ordinating the cellular response to DNA damage through activation of the ataxia telangiectasia and Rad3-related protein (ATR) kinase. The nucleoprotein complex protects the single-stranded DNA from nucleases, prevents formation of secondary structures that would interfere with repair, and co-ordinates the recruitment and departure of different genome maintenance factors. This subunit contains four oligonucleotide/oligosaccharide-binding (OB) domains, though the majority of ssDNA binding occurs in two of these domains. The heterotrimeric complex has two different modes of ssDNA binding, a low-affinity and high-affinity mode, determined by which ssDNA binding domains are utilized. The different binding modes differ in the length of DNA bound and in the proteins with which it interacts, thereby playing a role in regulating different genomic maintenance pathways. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 68kDa |
| NCBI: | 6117 |
| UniProt: | P27694 |
| Reinheit: | Affinity purification |
| Sequenz: | MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNE |
| Target-Kategorie: | RPA1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,DNA Damage Repair |


