CDK9 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CDK9 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0886
• Hersteller Artikelnummer: A0886
• Alternativnummer: ABB-A0886-100UL,ABB-A0886-20UL,ABB-A0886-500UL,ABB-A0886-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TAK, C-2k, CTK1, CDC2L4, PITALRE, CDK9

Produktbeschreibung

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 43kDa
• NCBI: 1025
• UniProt: P50750
• Reinheit: Affinity purification
• Sequenz: ANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
• Target-Kategorie: CDK9
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Cell Cycle,Immunology Inflammation

Bilder