CEBPA Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0904
Artikelname: CEBPA Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0904
Hersteller Artikelnummer: A0904
Alternativnummer: ABB-A0904-100UL,ABB-A0904-20UL,ABB-A0904-1000UL,ABB-A0904-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CEBP, C/EBP-alpha, CEBPA
This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 1050
UniProt: P49715
Reinheit: Affinity purification
Sequenz: APAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP
Target-Kategorie: CEBPA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Signal Transduction,Endocrine Metabolism,Cardiovascular,Lipids,Fatty Acids