LEF1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0909
Artikelname: LEF1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0909
Hersteller Artikelnummer: A0909
Alternativnummer: ABB-A0909-100UL,ABB-A0909-20UL,ABB-A0909-500UL,ABB-A0909-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LEF-1, TCF10, TCF7L3, TCF1ALPHA, LEF1
This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 51176
UniProt: Q9UJU2
Reinheit: Affinity purification
Sequenz: TDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLS
Target-Kategorie: LEF1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Cell Adhesion,Wnt -Catenin Signaling Pathway,Stem Cells