IKKgamma Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0917
- Bilder (2)
| Artikelname: | IKKgamma Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0917 |
| Hersteller Artikelnummer: | A0917 |
| Alternativnummer: | ABB-A0917-100UL,ABB-A0917-20UL,ABB-A0917-1000UL,ABB-A0917-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IP, IP1, IP2, FIP3, IKKG, IPD2, NEMO, FIP-3, Fip3p, IMD33, SAIDX, AMCBX1, EDAID1, IKKAP1, ZC2HC9, IKK-gamma, IKKgamma |
| This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 48 kDa/56 kDa/37 kDa |
| NCBI: | 8517 |
| UniProt: | Q9Y6K9 |
| Reinheit: | Affinity purification |
| Sequenz: | VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPE |
| Target-Kategorie: | IKBKG |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Kinase,Serine threonine kinases,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling,Cardiovascular |


