HES1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: HES1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0925
• Hersteller Artikelnummer: A0925
• Alternativnummer: ABB-A0925-100UL,ABB-A0925-20UL,ABB-A0925-1000UL,ABB-A0925-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HHL, HRY, HES-1, bHLHb39, HES1

Produktbeschreibung

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0513]
• Molekulargewicht: 30kDa
• NCBI: 3280
• UniProt: Q14469
• Reinheit: Affinity purification
• Sequenz: FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
• Target-Kategorie: HES1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:1000 - 1:4000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience

Bilder