MARCKS Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MARCKS Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0936
• Hersteller Artikelnummer: A0936
• Alternativnummer: ABB-A0936-20UL,ABB-A0936-100UL,ABB-A0936-500UL,ABB-A0936-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MACS, 80K-L, PKCSL, PRKCSL, MARCKS

Produktbeschreibung

The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 32kDa
• NCBI: 4082
• UniProt: P29966
• Reinheit: Affinity purification
• Sequenz: MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGA
• Target-Kategorie: MARCKS
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Cell Biology Developmental Biology,Cytoskeleton,Endocrine Metabolism,Neuroscience,Calcium Signaling,Cardiovascular

Bilder