SFPQ Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SFPQ Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0958
• Hersteller Artikelnummer: A0958
• Alternativnummer: ABB-A0958-100UL,ABB-A0958-20UL,ABB-A0958-1000UL,ABB-A0958-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PSF, POMP100, PPP1R140, SFPQ

Produktbeschreibung

Enables DNA binding activity, histone deacetylase binding activity, and protein homodimerization activity. Involved in several processes, including alternative mRNA splicing, via spliceosome, positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway, and regulation of transcription by RNA polymerase II. Acts upstream of or within double-strand break repair via homologous recombination. Located in chromatin, nuclear matrix, and paraspeckles.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 76kDa
• NCBI: 6421
• UniProt: P23246
• Reinheit: Affinity purification
• Sequenz: MMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
• Target-Kategorie: SFPQ
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding

Bilder