Caspase-1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Caspase-1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0964
• Hersteller Artikelnummer: A0964
• Alternativnummer: ABB-A0964-20UL,ABB-A0964-100UL,ABB-A0964-1000UL,ABB-A0964-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ICE, P45, IL1BC, Caspase-1

Produktbeschreibung

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 45kDa
• NCBI: 834
• UniProt: P29466
• Reinheit: Affinity purification
• Sequenz: DVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
• Target-Kategorie: CASP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Caspases,Endocrine Metabolism,Immunology Inflammation,Neuroscience,Neurodegenerative Diseases

Bilder