Human Parkin Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0968
- Bilder (2)
| Artikelname: | Human Parkin Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0968 |
| Hersteller Artikelnummer: | A0968 |
| Alternativnummer: | ABB-A0968-20UL,ABB-A0968-100UL,ABB-A0968-1000UL,ABB-A0968-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PDJ, AR-JP, LPRS2, PARK2, Parkin |
| The precise function of this gene is unknown, however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 52kDa |
| NCBI: | 5071 |
| UniProt: | O60260 |
| Reinheit: | Affinity purification |
| Sequenz: | NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHD |
| Target-Kategorie: | PRKN |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Autophagy,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,Jak-Stat-IL-6 Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Neurodegenerative Diseases Markers |
|
|
|
|
|
Produktgarantie und fachkundiger Support
