NEK8 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NEK8 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0984
• Hersteller Artikelnummer: A0984
• Alternativnummer: ABB-A0984-100UL,ABB-A0984-20UL,ABB-A0984-500UL,ABB-A0984-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: JCK, NPHP9, RHPD2, NEK12A, NEK8

Produktbeschreibung

This gene encodes a member of the serine/threionine protein kinase family related to NIMA (never in mitosis, gene A) of Aspergillus nidulans. The encoded protein may play a role in cell cycle progression from G2 to M phase. Mutations in the related mouse gene are associated with a disease phenotype that closely parallels the juvenile autosomal recessive form of polycystic kidney disease in humans.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 75kDa
• NCBI: 284086
• UniProt: Q86SG6
• Reinheit: Affinity purification
• Sequenz: GSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSG
• Target-Kategorie: NEK8
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|IF/ICC,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Kinase,Cell Cycle,Centrosome