Grp94 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Grp94 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0989
• Hersteller Artikelnummer: A0989
• Alternativnummer: ABB-A0989-100UL,ABB-A0989-20UL,ABB-A0989-1000UL,ABB-A0989-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ECGP, GP96, TRA1, GRP94, HEL35, HEL-S-125m, Grp94

Produktbeschreibung

This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this protein is associated with a variety of pathogenic states, including tumor formation. There is a microRNA gene located within the 5 exon of this gene. There are pseudogenes for this gene on chromosomes 1 and 15.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 92kDa
• NCBI: 7184
• UniProt: P14625
• Reinheit: Affinity purification
• Sequenz: EGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPME
• Target-Kategorie: HSP90B1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100|IF-P,1:50 - 1:100|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism

Bilder

Immunohistochemistry analysis of par