TLR7 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0991
- Bilder (2)
| Artikelname: | TLR7 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0991 |
| Hersteller Artikelnummer: | A0991 |
| Alternativnummer: | ABB-A0991-20UL,ABB-A0991-100UL,ABB-A0991-500UL,ABB-A0991-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IMD74, SLEB17, TLR7-like, TLR7 |
| The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. The human TLR family comprises 11 members. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. For the recognition of structural components in foreign microorganisms, the various TLRs exhibit different patterns of expression as well, in this way for example, TLR-3, -7, and -8 are essential in the recognition of single-stranded RNA viruses. TLR7 senses single-stranded RNA oligonucleotides containing guanosine- and uridine-rich sequences from RNA viruses, a recognition occuring in the endosomes of plasmacytoid dendritic cells and B cells. This gene is predominantly expressed in lung, placenta, and spleen, and is phylogenetically related and lies in close proximity to another family member, TLR8, on chromosome X. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 121kDa |
| NCBI: | 51284 |
| UniProt: | Q9NYK1 |
| Reinheit: | Affinity purification |
| Sequenz: | FPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTEL |
| Target-Kategorie: | TLR7 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Immunology Inflammation,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling |


