SYT1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SYT1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0992
• Hersteller Artikelnummer: A0992
• Alternativnummer: ABB-A0992-100UL,ABB-A0992-20UL,ABB-A0992-1000UL,ABB-A0992-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: P65, SYT, BAGOS, SVP65, SYT1

Produktbeschreibung

This gene encodes a member of the synaptotagmin protein family. The synaptotagmins are integral membrane proteins of synaptic vesicles that serve as calcium sensors in the process of vesicular trafficking and exocytosis. The encoded protein participates in triggering neurotransmitter release at the synapse in response to calcium binding. Mutations in this gene are associated with Baker-Gordon syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 48kDa
• NCBI: 6857
• UniProt: P21579
• Reinheit: Affinity purification
• Sequenz: LFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNN
• Target-Kategorie: SYT1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P, 5000-20000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker

Bilder