KLHL9 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10149
Artikelname: KLHL9 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10149
Hersteller Artikelnummer: A10149
Alternativnummer: ABB-A10149-100UL,ABB-A10149-20UL,ABB-A10149-500UL,ABB-A10149-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KLHL9
This gene encodes a protein that belongs to the kelch repeat-containing family, and contains an N-terminal BTB/POZ domain, a BACK domain and six C-terminal kelch repeats. The encoded protein is a component of a complex with cullin 3-based E3 ligase, which plays a role in mitosis. This protein complex is a cell cycle regulator, and functions in the organization and integrity of the spindle midzone in anaphase and the completion of cytokinesis. The complex is required for the removal of the chromosomal passenger protein aurora B from mitotic chromosomes.
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 55958
UniProt: Q9P2J3
Reinheit: Affinity purification
Sequenz: MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNK
Target-Kategorie: KLHL9
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway