Recombinant Monkeypox virus M1R Protein, Human

Artikelnummer: ABB-RP03292
Artikelname: Recombinant Monkeypox virus M1R Protein, Human
Artikelnummer: ABB-RP03292
Hersteller Artikelnummer: RP03292
Alternativnummer: ABB-RP03292-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Immunogen: Gly2-Gly183
Alternative Synonym: M1R, Monkeypox virus M1R, MPXV M1R
Monkeypox virus (MPXV) is double-stranded DNA virus belonging to the genus orthopoxvirus that causes a smallpox-like disease in humans. M1R is homologous to the vaccinia virus L1 protein, a transmembrane protein found on the surface of mature IMV particles. And M1R is the component of the entry fusion complex (EFC), which consists of 11 proteins. During cell infection, this complex mediates entry of the virion core into the host cytoplasm by a two-step mechanism consisting of lipid mixing of the viral and cellular membranes and subsequent pore formation.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 20.41 kDa
NCBI: 928968
UniProt: Q8V502
Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequenz: MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPMIIATTDIQN
Target-Kategorie: Monkeypox virus M1R
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein