Recombinant Human SLC3A2/CD98 Protein

Produktübersicht

• Artikelname: Recombinant Human SLC3A2/CD98 Protein
• Artikelnummer: ABB-RP03523
• Hersteller Artikelnummer: RP03523
• Alternativnummer: ABB-RP03523-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Arg206-Ala630
• Alternative Synonym: SLC3A2, MDU1,Amino acid transporter heavy chain SLC3A2,CD98

Produktbeschreibung

This protein is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 47.9 kDa
• NCBI: 6520
• UniProt: P08195
• Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Formulierung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Sequenz: RAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTL
• Target-Kategorie: SLC3A2, MDU1

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstituting to a concentration more than 100 µg/ml is recommended. Dissolve the lyophilized protein in distilled water. ResearchArea: Bio-Markers & CD Antigens