Recombinant Serratia marcescens Nuclease, Yeast

Artikelnummer: ABB-RPT0008LQ
Artikelname: Recombinant Serratia marcescens Nuclease, Yeast
Artikelnummer: ABB-RPT0008LQ
Hersteller Artikelnummer: RPT0008LQ
Alternativnummer: ABB-RPT0008LQ-20KU,ABB-RPT0008LQ-500KU,ABB-RPT0008LQ-100KU,ABB-RPT0008LQ-50KU
Hersteller: ABclonal
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Immunogen: Asp22-Asn266
Alternative Synonym: Endonuclease, Nuclease, nucA, nuc
Catalyzes the hydrolysis of both DNA and RNA, double- or single-stranded, at the 3position of the phosphodiester bond to produce 5-phosphorylated mono-, di-, tri- and tetranucleotides. DNA is a slightly better substrate than RNA.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 26.71 kDa
NCBI: 87005285
UniProt: P13717
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Solution in 50% glycerol containing 20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl.
Sequenz: DTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
Target-Kategorie: Nuclease
Application Verdünnung: Solution in 50% glycerol containing 20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl.
Anwendungsbeschreibung: ResearchArea: Tool proteins