Recombinant Human IgE Protein

Produktübersicht

• Artikelname: Recombinant Human IgE Protein
• Artikelnummer: ABB-RPT0015
• Hersteller Artikelnummer: RPT0015
• Alternativnummer: ABB-RPT0015-20UG,ABB-RPT0015-50UG,ABB-RPT0015-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Ser106-Gly427
• Alternative Synonym: Immunoglobulin heavy constant epsilon, Ig epsilon chain C region, Ig epsilon chain C region ND,IGHE,IgE

Produktbeschreibung

Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response, defense response to other organism, and phagocytosis. Predicted to be located in extracellular region. Predicted to be part of immunoglobulin complex, circulating. Predicted to be active in external side of plasma membrane.

Produkteigenschaften

• Konzentration: < 0.01 EU/µg of the protein by LAL method
• Molekulargewicht: 38.60 kDa
• NCBI: 3497
• UniProt: P01854
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: SRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWL
• Target-Kategorie: IgE

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifµge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein