Recombinant Human Rhinovirus Type 14 3C/ HRV 3C Protease, E. coli

Artikelnummer: ABB-RPT0039
Artikelname: Recombinant Human Rhinovirus Type 14 3C/ HRV 3C Protease, E. coli
Artikelnummer: ABB-RPT0039
Hersteller Artikelnummer: RPT0039
Alternativnummer: ABB-RPT0039-1000U,ABB-RPT0039-500U,ABB-RPT0039-100U
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Immunogen: Gly1538-Gln1719
Alternative Synonym: 3C,Protease 3C, Picornain 3C,Genome polyprotein
HRV 3C Protease encoded by human rhinovirus 14 is a highly purified recombinant cysteine protease with a His-tag. HRV 3C protease folds into two anti-parallel six-stranded beta-barrels and the site cleft is located at the junction of the two beta-barrels domains. The enzyme requires neither metal nor cofactors for activity. It has been demonstrated that the enzyme exhibits highest activity around neutral pH at temperature ranging from 22 to 37°C, even retaining robust activity at 4°C. Thus, cleavage can be performed at low temperature to enhance the stability of the target protein. The catalytic activity is insensitive to organic solvents (up to 10%), however, it can be strongly stimulated by high concentration of anions such as sulfate.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 20.00 kDa
NCBI: 1461213
UniProt: P03303
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from 0.22µm filtered solution in 50mM Tris ,150mM Nacl , 1mM EDTA, 1mM DTT , pH 7.0.
Sequenz: GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ
Target-Kategorie: 3C,Protease 3C, Picornain 3C
Application Verdünnung: Lyophilized from 0.22µm filtered solution in 50mM Tris ,150mM Nacl , 1mM EDTA, 1mM DTT , pH 7.0.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein