Anti-CAND2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88144-100
Artikelname: Anti-CAND2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88144-100
Hersteller Artikelnummer: A88144-100
Alternativnummer: ABC-A88144-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CAND2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 130 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: VGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAAGRPHTRSTVITAVKFLISD
Target-Kategorie: CAND2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200