Anti-USP25 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88148-100
Artikelname: Anti-USP25 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88148-100
Hersteller Artikelnummer: A88148-100
Alternativnummer: ABC-A88148-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human USP25 (NP_037528.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to USP25.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 130 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAKTPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRETGITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFA
Target-Kategorie: USP25
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200