Anti-LAMB3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88170-100
Artikelname: Anti-LAMB3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88170-100
Hersteller Artikelnummer: A88170-100
Alternativnummer: ABC-A88170-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 762-1004 of human LAMB3.
Konjugation: Unconjugated
Rabbit polyclonal antibody to LAMB3.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 130 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Formulierung: Liquid
Sequenz: TGSPKLVALRLEMSSLPDLTPTFNKLCGNSRQMACTPISCPGELCPQDNGTACGSRCRGVLPRAGGAFLMAGQVAEQLRGFNAQLQRTRQMIRAAEESASQIQSSAQRLETQVSASRSQMEEDVRRTRLLIQQVRDFLTDPDTDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDIARARRLQAEAEEARSRAHAVEGQVEDVVGNLRQGTVALQEAQDTMQGT
Target-Kategorie: LAMB3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500