Anti-LPXN
Artikelnummer:
ATA-HPA043741
- Bilder (6)
| Artikelname: | Anti-LPXN |
| Artikelnummer: | ATA-HPA043741 |
| Hersteller Artikelnummer: | HPA043741 |
| Alternativnummer: | ATA-HPA043741-100,ATA-HPA043741-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LDPL |
| leupaxin |
| Anti-LPXN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9404 |
| UniProt: | O60711 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSML |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LPXN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells, germinal center cells were moderately stained. |
|
|
Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-LPXN antibody. Corresponding LPXN RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
Western blot analysis using Anti-LPXN antibody HPA043741 (A) shows similar pattern to independent antibody HPA061441 (B). |
|
|
HPA043741-100ul |
|
|
HPA043741-100ul |
|
|
HPA043741-100ul |
Produktgarantie und fachkundiger Support
