Anti-SPHKAP
Artikelnummer:
ATA-HPA048168
- Bilder (6)
| Artikelname: | Anti-SPHKAP |
| Artikelnummer: | ATA-HPA048168 |
| Hersteller Artikelnummer: | HPA048168 |
| Alternativnummer: | ATA-HPA048168-100,ATA-HPA048168-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SKIP |
| SPHK1 interactor, AKAP domain containing |
| Anti-SPHKAP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 80309 |
| UniProt: | Q2M3C7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AQSTLQTKHPDIYCITDFAEELADTVVSMATEIAAICLDNSSGKQPWFCAWKRGSEFLMTPNVPCRSLKRKKESQGSGTAVRKHKPPRLSEIKRKTDEHP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SPHKAP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-SPHKAP antibody. Corresponding SPHKAP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
HPA048168-100ul |
|
|
HPA048168-100ul |
|
|
HPA048168-100ul |
Produktgarantie und fachkundiger Support
