Anti-PTH
Artikelnummer:
ATA-HPA048540
- Bilder (6)
| Artikelname: | Anti-PTH |
| Artikelnummer: | ATA-HPA048540 |
| Hersteller Artikelnummer: | HPA048540 |
| Alternativnummer: | ATA-HPA048540-100,ATA-HPA048540-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PTH1 |
| parathyroid hormone |
| Anti-PTH |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5741 |
| UniProt: | P01270 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PTH |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human parathyroid gland and cervix, uterine tissues using Anti-PTH antibody. Corresponding PTH RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human parathyroid gland shows high expression. |
|
|
Immunohistochemical staining of human cervix, uterine shows low expression as expected. |
|
|
HPA048540-100ul |
|
|
HPA048540-100ul |
|
|
HPA048540-100ul |
Produktgarantie und fachkundiger Support
