Anti-BTBD1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA067671
Artikelname: Anti-BTBD1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA067671
Hersteller Artikelnummer: HPA067671
Alternativnummer: ATA-HPA067671-25,ATA-HPA067671-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BTBD1
BTB (POZ) domain containing 1
Anti-BTBD1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 53339
UniProt: Q9H0C5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SSLGPLLPLQREPLYNWQATKASLKERFAFL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BTBD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human skeletal muscle and pancreas tissues using Anti-BTBD1 antibody. Corresponding BTBD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA067671
HPA067671
HPA067671