Recombinant Human Ribonuclease 7 (RNASE7), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Human Ribonuclease 7 (RNASE7), Unconjugated, E. coli
• Artikelnummer: BIM-RPC29775
• Hersteller Artikelnummer: RPC29775
• Alternativnummer: BIM-RPC29775-20UG,BIM-RPC29775-100UG,BIM-RPC29775-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: RNase 7, Skin-derived antimicrobial protein 2, SAP-2

Produktbeschreibung

Accession Number: Q9H1E1; RNASE7. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 29-156aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Epigenetics, Nuclear Signaling. Shipping Condition: Ice packs. Short Description: Recombinant Human Ribonuclease 7 (RNASE7) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 18.6kDa
• Tag: N-Terminal 6xHis-Tagged
• Reinheit: >85% by SDS-PAGE
• Sequenz: KPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL
• Target-Kategorie: Ribonuclease 7 (RNASE7)