Recombinant Human Somatostatin receptor type 2 (SSTR2) -VLPs , Active Protein, Unconjugated, Mammal

Produktübersicht

• Artikelname: Recombinant Human Somatostatin receptor type 2 (SSTR2) -VLPs , Active Protein, Unconjugated, Mammal
• Artikelnummer: BIM-RPC29776
• Hersteller Artikelnummer: RPC29776
• Alternativnummer: BIM-RPC29776-20UG,BIM-RPC29776-100UG,BIM-RPC29776-1MG
• Hersteller: Biomatik Corporation
• Wirt: Mammal
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: SSTR2, Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SRIF-1

Produktbeschreibung

Accession Number: P30874; SSTR2. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 1-369aa. Protein Length: Full Length. Protein Type: MP-VLP Transmembrane Protein; Active Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Somatostatin receptor type 2 (SSTR2) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein

Produkteigenschaften

• Molekulargewicht: 42.5kDa
• Tag: C-Terminal 6xHis-Tagged (This tag can be tested only under denaturing conditions)
• Reinheit: The purity information is not available for VLPs proteins
• Sequenz: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKV
• Target-Kategorie: Somatostatin receptor type 2 (SSTR2) -VLPs