Recombinant Human Tenascin (TNC), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC29778
Artikelname: Recombinant Human Tenascin (TNC), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC29778
Hersteller Artikelnummer: RPC29778
Alternativnummer: BIM-RPC29778-20UG,BIM-RPC29778-100UG,BIM-RPC29778-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cytotactin, GMEMGP 150-225Glioma-associated-Extracellular domain matrix antigenHexabrachionJIMyotendinous antigenNeuronectin, Tenascin-C, TN-C
Accession Number: P24821; TNC. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1888-2201aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Signal Transduction. Shipping Condition: Ice packs. Short Description: Recombinant Human Tenascin (TNC), partial is a purified Recombinant Protein
Molekulargewicht: 39.5kDa
Tag: N-Terminal 6xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYK
Target-Kategorie: Tenascin (TNC)