Recombinant Human Selenoprotein P (SELENOP, U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S), Unconjugated, Yeast

Produktübersicht

• Artikelname: Recombinant Human Selenoprotein P (SELENOP, U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S), Unconjugated, Yeast
• Artikelnummer: BIM-RPC29780
• Hersteller Artikelnummer: RPC29780
• Alternativnummer: BIM-RPC29780-20UG,BIM-RPC29780-100UG,BIM-RPC29780-1MG
• Hersteller: Biomatik Corporation
• Wirt: Yeast
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Selenoprotein P, Selenoprotein P plasma 1, Selp, SeP, Sepp1, SEPP1_HUMAN

Produktbeschreibung

Accession Number: P49908; SELENOP. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 20-381aa(U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S). Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human Selenoprotein P (SELENOP; U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 42.6kDa
• Tag: N-Terminal 6xHis-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQ
• Target-Kategorie: Selenoprotein P (SELENOP, U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S)