Recombinant Human Testisin (PRSS21), Unconjugated, E. coli

Artikelnummer: BIM-RPC29789
Artikelname: Recombinant Human Testisin (PRSS21), Unconjugated, E. coli
Artikelnummer: BIM-RPC29789
Hersteller Artikelnummer: RPC29789
Alternativnummer: BIM-RPC29789-20UG,BIM-RPC29789-100UG,BIM-RPC29789-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Eosinophil serine protease 1
Accession Number: Q9Y6M0; PRSS21. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 42-288aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Testisin (PRSS21) is a purified Recombinant Protein
Molekulargewicht: 31.8kDa
Tag: N-Terminal 6xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS
Target-Kategorie: Testisin (PRSS21)