NEMF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089010
Artikelname: NEMF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089010
Hersteller Artikelnummer: orb2089010
Alternativnummer: BYT-ORB2089010-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NEMF
Konjugation: HRP
Alternative Synonym: IDDSAPN, NY-CO-1, SDCCAG1
NEMF Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 118kDa
NCBI: 004704
UniProt: O60524
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP