Tag type will be determined during the manufacturing process. (Note:If you have specified tag type, please tell us or remark on your PO and we will develop the specified tag preferentially.)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reinheit:
Greater than 85% as determined by SDS-PAGE.
Formulierung:
Liquid or Lyophilized powder
Sequenz:
Partial
Target-Kategorie:
LFYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWR
Anwendungsbeschreibung:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten