RCC1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A0662
Article Name: RCC1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0662
Supplier Catalog Number: A0662
Alternative Catalog Number: ABB-A0662-20UL,ABB-A0662-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CHC1, RCC1-I, RCC1
Enables several functions, including guanyl-nucleotide exchange factor activity, nucleosomal DNA binding activity, and protein heterodimerization activity. Involved in several processes, including G1/S transition of mitotic cell cycle, regulation of mitotic nuclear division, and spindle organization. Located in chromatin, cytoplasm, and nucleus. Part of protein-containing complex.
Clonality: Monoclonal
Clone Designation: [ARC1834]
Molecular Weight: 45kDa
NCBI: 1104
UniProt: P18754
Purity: Affinity purification
Sequence: MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALG
Target: RCC1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle