hnRNP K Rabbit mAb, Unconjugated

Catalog Number: ABB-A0772
Article Name: hnRNP K Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0772
Supplier Catalog Number: A0772
Alternative Catalog Number: ABB-A0772-20UL,ABB-A0772-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AUKS, CSBP, TUNP, HNRPK, hnRNP K
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference, it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Several alternatively spliced transcript variants have been described for this gene, however, not all of them are fully characterized.
Clonality: Monoclonal
Clone Designation: [ARC0512]
Molecular Weight: 49kDa/51kDa
NCBI: 3190
UniProt: P61978
Purity: Affinity purification
Sequence: METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI
Target: HNRNPK
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding