ADAM17 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0821
Article Name: ADAM17 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0821
Supplier Catalog Number: A0821
Alternative Catalog Number: ABB-A0821-100UL,ABB-A0821-20UL,ABB-A0821-1000UL,ABB-A0821-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CSVP, TACE, NISBD, ADAM18, CD156B, NISBD1, ADAM17
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. The encoded protease functions in the ectodomain shedding of tumor necrosis factor-alpha, in which soluble tumor necrosis factor-alpha is released from the membrane-bound precursor. This protease also functions in the processing of numerous other substrates, including cell adhesion proteins, cytokine and growth factor receptors and epidermal growth factor (EGF) receptor ligands, and plays a prominent role in the activation of the Notch signaling pathway. Elevated expression of this gene has been observed in specific cell types derived from psoriasis, rheumatoid arthritis, multiple sclerosis and Crohns disease patients, suggesting that the encoded protein may play a role in autoimmune disease. Additionally, this protease may play a role in viral infection through its cleavage of ACE2, the cellular receptor for SARS-CoV and SARS-CoV-2.
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 6868
UniProt: P78536
Purity: Affinity purification
Sequence: KQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC
Target: ADAM17
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Extracellular Matrix,Ubiquitin,Endocrine Metabolism,Immunology Inflammation,CDs,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Stem Cells