PDK1/PDHK1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0834
Article Name: PDK1/PDHK1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0834
Supplier Catalog Number: A0834
Alternative Catalog Number: ABB-A0834-100UL,ABB-A0834-20UL,ABB-A0834-500UL,ABB-A0834-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PDK1, PDK1/PDHK1
Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 5163
UniProt: Q15118
Purity: Affinity purification
Sequence: STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
Target: PDK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,PI3K-Akt Signaling Pathway,Endocrine Metabolism,Carbohydrate metabolism,Warburg Effect,Immunology Inflammation,T Cell Receptor Signaling Pathway,NF-kB Signaling Pathway