Integrin beta 4 (ITGB4/CD104) Rabbit pAb, Unconjugated

Catalog Number: ABB-A0857
Article Name: Integrin beta 4 (ITGB4/CD104) Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0857
Supplier Catalog Number: A0857
Alternative Catalog Number: ABB-A0857-100UL,ABB-A0857-20UL,ABB-A0857-500UL,ABB-A0857-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CD104, GP150, JEB5A, JEB5B, Integrin beta 4 (ITGB4/CD104)
Integrins are heterodimers comprised of alpha and beta subunits, that are noncovalently associated transmembrane glycoprotein receptors. Different combinations of alpha and beta polypeptides form complexes that vary in their ligand-binding specificities. Integrins mediate cell-matrix or cell-cell adhesion, and transduced signals that regulate gene expression and cell growth. This gene encodes the integrin beta 4 subunit, a receptor for the laminins. This subunit tends to associate with alpha 6 subunit and is likely to play a pivotal role in the biology of invasive carcinoma. Mutations in this gene are associated with epidermolysis bullosa with pyloric atresia. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 202kDa
NCBI: 3691
UniProt: P16144
Purity: Affinity purification
Sequence: DTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGS
Target: ITGB4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs