[KO Validated] LDHA Rabbit mAb, Unconjugated

Catalog Number: ABB-A0861
Article Name: [KO Validated] LDHA Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0861
Supplier Catalog Number: A0861
Alternative Catalog Number: ABB-A0861-100UL,ABB-A0861-20UL,ABB-A0861-1000UL,ABB-A0861-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LDHM, GSD11, PIG19, HEL-S-133P, HA
The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Clonality: Monoclonal
Clone Designation: [ARC2669]
Molecular Weight: 26-39 kDa
NCBI: 3939
UniProt: P00338
Purity: Affinity purification
Sequence: VWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
Target: LDHA
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IF/ICC,1:100 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Warburg Effect