cIAP1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0866
Article Name: cIAP1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0866
Supplier Catalog Number: A0866
Alternative Catalog Number: ABB-A0866-20UL,ABB-A0866-100UL,ABB-A0866-1000UL,ABB-A0866-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: API1, MIHB, HIAP2, RNF48, cIAP1, Hiap-2, c-IAP1
The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 329
UniProt: Q13490
Purity: Affinity purification
Sequence: PRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
Target: BIRC2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Apoptosis,Caspases,Inhibition of Apoptosis,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Death Receptor Signaling Pathway,Endocrine Metabolism,Immunology Inflammation