CEBPA Rabbit pAb, Unconjugated

Catalog Number: ABB-A0904
Article Name: CEBPA Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0904
Supplier Catalog Number: A0904
Alternative Catalog Number: ABB-A0904-100UL,ABB-A0904-20UL,ABB-A0904-1000UL,ABB-A0904-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CEBP, C/EBP-alpha, CEBPA
This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons.
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 1050
UniProt: P49715
Purity: Affinity purification
Sequence: APAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP
Target: CEBPA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Signal Transduction,Endocrine Metabolism,Cardiovascular,Lipids,Fatty Acids