LEF1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0909
Article Name: LEF1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0909
Supplier Catalog Number: A0909
Alternative Catalog Number: ABB-A0909-100UL,ABB-A0909-20UL,ABB-A0909-500UL,ABB-A0909-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LEF-1, TCF10, TCF7L3, TCF1ALPHA, LEF1
This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 51176
UniProt: Q9UJU2
Purity: Affinity purification
Sequence: TDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLS
Target: LEF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Cell Adhesion,Wnt -Catenin Signaling Pathway,Stem Cells