IKKgamma Rabbit pAb, Unconjugated

Catalog Number: ABB-A0917
Article Name: IKKgamma Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0917
Supplier Catalog Number: A0917
Alternative Catalog Number: ABB-A0917-100UL,ABB-A0917-20UL,ABB-A0917-1000UL,ABB-A0917-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IP, IP1, IP2, FIP3, IKKG, IPD2, NEMO, FIP-3, Fip3p, IMD33, SAIDX, AMCBX1, EDAID1, IKKAP1, ZC2HC9, IKK-gamma, IKKgamma
This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome.
Clonality: Polyclonal
Molecular Weight: 48 kDa/56 kDa/37 kDa
NCBI: 8517
UniProt: Q9Y6K9
Purity: Affinity purification
Sequence: VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPE
Target: IKBKG
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Kinase,Serine threonine kinases,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling,Cardiovascular