HES1 Rabbit mAb, Unconjugated

Product Overview

• Article Name: HES1 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A0925
• Supplier Catalog Number: A0925
• Alternative Catalog Number: ABB-A0925-100UL,ABB-A0925-20UL,ABB-A0925-1000UL,ABB-A0925-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HHL, HRY, HES-1, bHLHb39, HES1

Product Description

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0513]
• Molecular Weight: 30kDa
• NCBI: 3280
• UniProt: Q14469
• Purity: Affinity purification
• Sequence: FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
• Target: HES1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:1000 - 1:4000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience

Images