MARCKS Rabbit pAb, Unconjugated

Product Overview

• Article Name: MARCKS Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0936
• Supplier Catalog Number: A0936
• Alternative Catalog Number: ABB-A0936-20UL,ABB-A0936-100UL,ABB-A0936-500UL,ABB-A0936-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MACS, 80K-L, PKCSL, PRKCSL, MARCKS

Product Description

The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 32kDa
• NCBI: 4082
• UniProt: P29966
• Purity: Affinity purification
• Sequence: MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGA
• Target: MARCKS
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Cell Biology Developmental Biology,Cytoskeleton,Endocrine Metabolism,Neuroscience,Calcium Signaling,Cardiovascular

Images